PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0002s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB_related
Protein Properties Length: 374aa    MW: 40152.9 Da    PI: 7.7187
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0002s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding391.8e-12115159347
                             SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
         Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                             +WT++E+ l++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qk+
  SapurV1A.0002s0030.1.p 115 PWTEDEHRLFLIGLQKLGKGDWRGIARNFVVSRTPTQVASHAQKF 159
                             8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.715108164IPR017930Myb domain
SuperFamilySSF466895.54E-16110165IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-18111163IPR006447Myb domain, plants
SMARTSM007173.5E-9112162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-10112155IPR009057Homeodomain-like
CDDcd001674.39E-8115160No hitNo description
PfamPF002491.6E-9115158IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RSSLASSSSS PLSGVKLFGV RLTDGSIIKK SASMGNLSAH  60
YHSSSSAAAS PNPDSPLSDH IRDSAHVPDG YLSDDPAAHA SCSTNQRGDR KKGVPWTEDE  120
HRLFLIGLQK LGKGDWRGIA RNFVVSRTPT QVASHAQKFF IRQSNATRRK RRSSLFDMVP  180
EMATDPQAVT EEQELPSSSR AGDTGNADSL PSLSLSLKPE FEPMDIASQE LVKEPDKIMT  240
GLSEIKPTVP SSGEFGPCSS EFTAVPGFFP AYVPVPYPYW PPNTSLIEEG KSAAAPHHEV  300
LKPVAVIPKE PFIVDELVGM SHLHLGEKTD RHRREPSPLS LKLTGEPSRQ SAFHASAPPA  360
GGSDLSDGKA SSI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011012039.10.0PREDICTED: uncharacterized protein LOC105116394
TrEMBLA9PIL70.0A9PIL7_9R
STRINGGLYMA13G43120.11e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-79MYB_related family protein